SCOP 1.67: Domain d1mfbh2: 1mfb H:368-468

Lineage for d1mfbh2 (1mfb H:368-468)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1mfbh2: 1mfb H:368-468 [20985]
   Other proteins in same PDB: d1mfbh1, d1mfbl1, d1mfbl2
   part of Fab SE155-4
   complexed with abe, gal, man, ram

Details for d1mfbh2

PDB Entry: 1mfb, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfbh2:

Sequence, based on SEQRES records:

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1mfbh2:

• d1mfbh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfbh2 appears in SCOP 1.65
  
• d1mfbh2 appears in SCOP 1.69
  
• d1mfbh2 appears in the current release, SCOPe 2.08