Lineage for d1mfbh2 (1mfb H:368-468)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9105Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)
  8. 9106Domain d1mfbh2: 1mfb H:368-468 [20985]
    Other proteins in same PDB: d1mfbh1, d1mfbl1

Details for d1mfbh2

PDB Entry: 1mfb (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfbh2:

Sequence, based on SEQRES records: (download)

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1mfbh2:

Click to download the PDB-style file with coordinates for d1mfbh2.
(The format of our PDB-style files is described here.)

Timeline for d1mfbh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfbh1