Lineage for d3fcpc1 (3fcp C:5-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948281Species Klebsiella pneumoniae [TaxId:272620] [225571] (1 PDB entry)
  8. 2948284Domain d3fcpc1: 3fcp C:5-131 [209848]
    Other proteins in same PDB: d3fcpa2, d3fcpa3, d3fcpb2, d3fcpc2, d3fcpd2, d3fcpe2, d3fcpf2, d3fcpg2, d3fcph2, d3fcph3
    automated match to d1f9ca2
    complexed with mg

Details for d3fcpc1

PDB Entry: 3fcp (more details), 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae
PDB Compounds: (C:) L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme

SCOPe Domain Sequences for d3fcpc1:

Sequence, based on SEQRES records: (download)

>d3fcpc1 d.54.1.0 (C:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
atveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsygves
peaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglp
vsallgg

Sequence, based on observed residues (ATOM records): (download)

>d3fcpc1 d.54.1.0 (C:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallgg

SCOPe Domain Coordinates for d3fcpc1:

Click to download the PDB-style file with coordinates for d3fcpc1.
(The format of our PDB-style files is described here.)

Timeline for d3fcpc1: