Lineage for d1mfbl2 (1mfb L:112-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2361010Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2361011Domain d1mfbl2: 1mfb L:112-212 [20984]
    Other proteins in same PDB: d1mfbh1, d1mfbh2, d1mfbl1
    part of Fab SE155-4

Details for d1mfbl2

PDB Entry: 1mfb (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfbl2 b.1.1.2 (L:112-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

SCOPe Domain Coordinates for d1mfbl2:

Click to download the PDB-style file with coordinates for d1mfbl2.
(The format of our PDB-style files is described here.)

Timeline for d1mfbl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfbl1