Lineage for d1mamh2 (1mam H:120-217)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9125Species Fab Yst9.1 (mouse), kappa L chain [48995] (1 PDB entry)
  8. 9126Domain d1mamh2: 1mam H:120-217 [20983]
    Other proteins in same PDB: d1mamh1, d1maml1

Details for d1mamh2

PDB Entry: 1mam (more details), 2.45 Å

PDB Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen

SCOP Domain Sequences for d1mamh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mamh2 b.1.1.2 (H:120-217) Immunoglobulin (constant domains of L and H chains) {Fab Yst9.1 (mouse), kappa L chain}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle

SCOP Domain Coordinates for d1mamh2:

Click to download the PDB-style file with coordinates for d1mamh2.
(The format of our PDB-style files is described here.)

Timeline for d1mamh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mamh1