Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d1acyh2: 1acy H:113-226 [20981] Other proteins in same PDB: d1acyh1, d1acyl1, d1acyl2 part of Fab 59.1 |
PDB Entry: 1acy (more details), 3 Å
SCOP Domain Sequences for d1acyh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acyh2 b.1.1.2 (H:113-226) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
Timeline for d1acyh2: