SCOP 1.67: Domain d1acyh2: 1acy H:113-226

Lineage for d1acyh2 (1acy H:113-226)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1acyh2: 1acy H:113-226 [20981]
   Other proteins in same PDB: d1acyh1, d1acyl1, d1acyl2
   part of Fab 59.1

Details for d1acyh2

PDB Entry: 1acy, 3 Å

PDB Description: crystal structure of the principal neutralizing site of hiv-1

SCOP Domain Sequences for d1acyh2:

Sequence; same for both SEQRES and ATOM records:

>d1acyh2 b.1.1.2 (H:113-226) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1acyh2:

• d1acyh2 first appeared (with stable ids) in SCOP 1.55
  
• d1acyh2 appears in SCOP 1.65
  
• d1acyh2 appears in SCOP 1.69
  
• d1acyh2 appears in the current release, SCOPe 2.07