Lineage for d3f5la_ (3f5l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832895Species Oryza sativa [TaxId:39947] [225407] (30 PDB entries)
  8. 2832896Domain d3f5la_: 3f5l A: [209799]
    automated match to d1v03a_
    complexed with mes, so4, zn; mutant

Details for d3f5la_

PDB Entry: 3f5l (more details), 1.37 Å

PDB Description: semi-active e176q mutant of rice bglu1, a plant exoglucanase/beta- glucosidase
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3f5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5la_ c.1.8.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

SCOPe Domain Coordinates for d3f5la_:

Click to download the PDB-style file with coordinates for d3f5la_.
(The format of our PDB-style files is described here.)

Timeline for d3f5la_: