Lineage for d3f5ja_ (3f5j A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095708Species Oryza sativa [TaxId:39947] [225407] (27 PDB entries)
  8. 2095738Domain d3f5ja_: 3f5j A: [209795]
    automated match to d1v03a_
    complexed with ctt, mes, so4, zn; mutant

Details for d3f5ja_

PDB Entry: 3f5j (more details), 1.95 Å

PDB Description: semi-active e176q mutant of rice bglu1, a plant exoglucanase/beta- glucosidase
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3f5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5ja_ c.1.8.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

SCOPe Domain Coordinates for d3f5ja_:

Click to download the PDB-style file with coordinates for d3f5ja_.
(The format of our PDB-style files is described here.)

Timeline for d3f5ja_: