SCOPe 2.04: Domain d3f4vb_: 3f4v B:

Lineage for d3f4vb_ (3f4v B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (60 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [225407] (23 PDB entries)

8. Domain d3f4vb_: 3f4v B: [209794]
   automated match to d1v03a_
   complexed with gol, mes, so4, zn; mutant

Details for d3f4vb_

PDB Entry: 3f4v, 1.65 Å

PDB Description: Semi-active E176Q mutant of rice BGlu1, a plant exoglucanase/beta-glucosidase

PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d3f4vb_:

Sequence; same for both SEQRES and ATOM records:

>d3f4vb_ c.1.8.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

Timeline for d3f4vb_:

• d3f4vb_ first appeared in SCOPe 2.03
  
• d3f4vb_ appears in SCOPe 2.05
  
• d3f4vb_ appears in the current release, SCOPe 2.08