Lineage for d1ai1h2 (1ai1 H:113-226)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8766Species Fab 59.1 (mouse), kappa L chain [48994] (2 PDB entries)
  8. 8767Domain d1ai1h2: 1ai1 H:113-226 [20979]
    Other proteins in same PDB: d1ai1h1, d1ai1l1

Details for d1ai1h2

PDB Entry: 1ai1 (more details), 2.8 Å

PDB Description: hiv-1 v3 loop mimic

SCOP Domain Sequences for d1ai1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ai1h2 b.1.1.2 (H:113-226) Immunoglobulin (constant domains of L and H chains) {Fab 59.1 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1ai1h2:

Click to download the PDB-style file with coordinates for d1ai1h2.
(The format of our PDB-style files is described here.)

Timeline for d1ai1h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ai1h1