Lineage for d3f0aa_ (3f0a A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969487Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries)
  8. 2969495Domain d3f0aa_: 3f0a A: [209751]
    automated match to d1tiqa_
    complexed with aco, cl, ni

Details for d3f0aa_

PDB Entry: 3f0a (more details), 2.5 Å

PDB Description: structure of a putative n-acetyltransferase (ta0374) in complex with acetyl-coa from thermoplasma acidophilum
PDB Compounds: (A:) n-acetyltransferase

SCOPe Domain Sequences for d3f0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0aa_ d.108.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn
ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi
lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky

SCOPe Domain Coordinates for d3f0aa_:

Click to download the PDB-style file with coordinates for d3f0aa_.
(The format of our PDB-style files is described here.)

Timeline for d3f0aa_: