SCOPe 2.08: Domain d3eyvh2: 3eyv H:120-219

Lineage for d3eyvh2 (3eyv H:120-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3eyvh2: 3eyv H:120-219 [209748]
   Other proteins in same PDB: d3eyva1, d3eyva2, d3eyvb1, d3eyvh1, d3eyvl1, d3eyvl2
   automated match to d1s3kh2
   complexed with gol, zn

Details for d3eyvh2

PDB Entry: 3eyv, 2.5 Å

PDB Description: anti-lewis y fab fragment with lewis y antigen in the presence of zinc ions

PDB Compounds: (H:) hu3S193 Fab, heavy chain

SCOPe Domain Sequences for d3eyvh2:

Sequence; same for both SEQRES and ATOM records:

>d3eyvh2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d3eyvh2:

• d3eyvh2 first appeared in SCOPe 2.03
  
• d3eyvh2 appears in SCOPe 2.07