SCOPe 2.03: Domain d3eyqc2: 3eyq C:109-212

Lineage for d3eyqc2 (3eyq C:109-212)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3eyqc2: 3eyq C:109-212 [209742]
   Other proteins in same PDB: d3eyqc1
   automated match to d1rhha2

Details for d3eyqc2

PDB Entry: 3eyq, 2.4 Å

PDB Description: Crystal structure of MJ5 Fab, a germline antibody variant of anti-human cytomegalovirus antibody 8f9

PDB Compounds: (C:) M2J5 Fab

SCOPe Domain Sequences for d3eyqc2:

Sequence; same for both SEQRES and ATOM records:

>d3eyqc2 b.1.1.2 (C:109-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3eyqc2:

• d3eyqc2 is new in SCOPe 2.03-stable
  
• d3eyqc2 appears in SCOPe 2.04
  
• d3eyqc2 appears in the current release, SCOPe 2.08