SCOP 1.65: Domain d1ggim2: 1ggi M:108-211

Lineage for d1ggim2 (1ggi M:108-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1ggim2: 1ggi M:108-211 [20974]
   Other proteins in same PDB: d1ggih1, d1ggih2, d1ggij1, d1ggij2, d1ggil1, d1ggim1
   part of Fab 50.1

Details for d1ggim2

PDB Entry: 1ggi, 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggim2:

Sequence; same for both SEQRES and ATOM records:

>d1ggim2 b.1.1.2 (M:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1ggim2:

• d1ggim2 first appeared (with stable ids) in SCOP 1.55
  
• d1ggim2 appears in SCOP 1.63
  
• d1ggim2 appears in SCOP 1.67
  
• d1ggim2 appears in the current release, SCOPe 2.08