Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab 50.1 (mouse), kappa L chain [48993] (3 PDB entries) |
Domain d1ggim2: 1ggi M:108-211 [20974] Other proteins in same PDB: d1ggih1, d1ggij1, d1ggil1, d1ggim1 |
PDB Entry: 1ggi (more details), 2.8 Å
SCOP Domain Sequences for d1ggim2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggim2 b.1.1.2 (M:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 50.1 (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1ggim2: