Lineage for d1ggih2 (1ggi H:113-228)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289381Domain d1ggih2: 1ggi H:113-228 [20973]
    Other proteins in same PDB: d1ggih1, d1ggij1, d1ggil1, d1ggil2, d1ggim1, d1ggim2

Details for d1ggih2

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggih2 b.1.1.2 (H:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ggih2:

Click to download the PDB-style file with coordinates for d1ggih2.
(The format of our PDB-style files is described here.)

Timeline for d1ggih2: