SCOPe 2.03: Domain d3exib2: 3exi B:186-329

Lineage for d3exib2 (3exi B:186-329)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
   automatically mapped to Pfam PF02780

6. Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89713] (5 PDB entries)

8. Domain d3exib2: 3exi B:186-329 [209724]
   Other proteins in same PDB: d3exia_, d3exib1
   automated match to d1umdb2
   complexed with cl, k

Details for d3exib2

PDB Entry: 3exi, 2.2 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exib2:

Sequence; same for both SEQRES and ATOM records:

>d3exib2 c.48.1.2 (B:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni

Timeline for d3exib2:

• d3exib2 is new in SCOPe 2.03-stable
  
• d3exib2 appears in SCOPe 2.04
  
• d3exib2 appears in the current release, SCOPe 2.08