Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89713] (7 PDB entries) |
Domain d3exhf2: 3exh F:186-329 [209718] Other proteins in same PDB: d3exha1, d3exha2, d3exhb1, d3exhc1, d3exhc2, d3exhd1, d3exhe1, d3exhe2, d3exhf1, d3exhg1, d3exhg2, d3exhh1 automated match to d1umdb2 complexed with gol, k, mn, tpp |
PDB Entry: 3exh (more details), 2.44 Å
SCOPe Domain Sequences for d3exhf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exhf2 c.48.1.2 (F:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya kilednsipqvkdiifaikktlni
Timeline for d3exhf2: