SCOPe 2.07: Domain d3exhd2: 3exh D:186-329

Lineage for d3exhd2 (3exh D:186-329)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries)

8. Domain d3exhd2: 3exh D:186-329 [209715]
   Other proteins in same PDB: d3exha1, d3exha2, d3exhb1, d3exhc1, d3exhc2, d3exhd1, d3exhe1, d3exhe2, d3exhf1, d3exhg1, d3exhg2, d3exhh1
   automated match to d1umdb2
   complexed with gol, k, mn, tpp

Details for d3exhd2

PDB Entry: 3exh, 2.44 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exhd2:

Sequence; same for both SEQRES and ATOM records:

>d3exhd2 c.48.1.2 (D:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni

Timeline for d3exhd2:

• d3exhd2 first appeared in SCOPe 2.03
  
• d3exhd2 appears in SCOPe 2.06
  
• d3exhd2 appears in the current release, SCOPe 2.08