SCOPe 2.06: Domain d3exhc1: 3exh C:1-361

Lineage for d3exhc1 (3exh C:1-361)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)

8. Domain d3exhc1: 3exh C:1-361 [209713]
   Other proteins in same PDB: d3exha2, d3exhb1, d3exhb2, d3exhc2, d3exhd1, d3exhd2, d3exhe2, d3exhf1, d3exhf2, d3exhg2, d3exhh1, d3exhh2
   automated match to d1ni4a_
   complexed with gol, k, mn, tpp

Details for d3exhc1

PDB Entry: 3exh, 2.44 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (C:) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

SCOPe Domain Sequences for d3exhc1:

Sequence; same for both SEQRES and ATOM records:

>d3exhc1 c.36.1.11 (C:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

Timeline for d3exhc1:

• d3exhc1 first appeared in SCOPe 2.03, called d3exhc_
  
• d3exhc1 was called d3exhc_ in SCOPe 2.05
  
• d3exhc1 appears in SCOPe 2.07
  
• d3exhc1 appears in the current release, SCOPe 2.08