Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries) |
Domain d3exeh2: 3exe H:186-329 [209709] Other proteins in same PDB: d3exea1, d3exea2, d3exeb1, d3exec1, d3exec2, d3exed1, d3exee_, d3exef1, d3exeg1, d3exeg2, d3exeh1 automated match to d1umdb2 complexed with gol, k, mn, tpp |
PDB Entry: 3exe (more details), 1.98 Å
SCOPe Domain Sequences for d3exeh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exeh2 c.48.1.2 (H:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya kilednsipqvkdiifaikktlni
Timeline for d3exeh2: