Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89652] (5 PDB entries) |
Domain d3exee_: 3exe E: [209704] Other proteins in same PDB: d3exeb1, d3exeb2, d3exed1, d3exed2, d3exef1, d3exef2, d3exeh1, d3exeh2 automated match to d1ni4a_ complexed with gol, k, mn, tpp |
PDB Entry: 3exe (more details), 1.98 Å
SCOPe Domain Sequences for d3exee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exee_ c.36.1.11 (E:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn maalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrfa aaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsnl asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv s
Timeline for d3exee_: