Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226777] (4 PDB entries) |
Domain d3exed1: 3exe D:1-185 [209702] Other proteins in same PDB: d3exea1, d3exea2, d3exeb2, d3exec1, d3exec2, d3exed2, d3exee_, d3exef2, d3exeg1, d3exeg2, d3exeh2 automated match to d1umdb1 complexed with gol, k, mn, tpp |
PDB Entry: 3exe (more details), 1.98 Å
SCOPe Domain Sequences for d3exed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exed1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf efppe
Timeline for d3exed1: