Lineage for d3exed1 (3exe D:1-185)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2122984Species Human (Homo sapiens) [TaxId:9606] [226777] (4 PDB entries)
  8. 2122988Domain d3exed1: 3exe D:1-185 [209702]
    Other proteins in same PDB: d3exea1, d3exea2, d3exeb2, d3exec1, d3exec2, d3exed2, d3exee_, d3exef2, d3exeg1, d3exeg2, d3exeh2
    automated match to d1umdb1
    complexed with gol, k, mn, tpp

Details for d3exed1

PDB Entry: 3exe (more details), 1.98 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exed1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

SCOPe Domain Coordinates for d3exed1:

Click to download the PDB-style file with coordinates for d3exed1.
(The format of our PDB-style files is described here.)

Timeline for d3exed1: