Lineage for d1ggbl2 (1ggb L:108-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8757Species Fab 50.1 (mouse), kappa L chain [48993] (3 PDB entries)
  8. 8759Domain d1ggbl2: 1ggb L:108-211 [20970]
    Other proteins in same PDB: d1ggbh1, d1ggbl1

Details for d1ggbl2

PDB Entry: 1ggb (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

SCOP Domain Sequences for d1ggbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggbl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1ggbl2:

Click to download the PDB-style file with coordinates for d1ggbl2.
(The format of our PDB-style files is described here.)

Timeline for d1ggbl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggbl1