SCOPe 2.03: Domain d3ewaa1: 3ewa A:2-63

Lineage for d3ewaa1 (3ewa A:2-63)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.0: automated matches [227240] (1 protein)
   not a true family

6. Protein automated matches [227003] (1 species)
   not a true protein

7. Species Methanococcus maripaludis [TaxId:39152] [225662] (3 PDB entries)

8. Domain d3ewaa1: 3ewa A:2-63 [209685]
   Other proteins in same PDB: d3ewaa2
   automated match to d1pzna1
   protein/DNA complex; complexed with anp, mg

Details for d3ewaa1

PDB Entry: 3ewa, 2 Å

PDB Description: rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3ewaa1:

Sequence; same for both SEQRES and ATOM records:

>d3ewaa1 a.60.4.0 (A:2-63) automated matches {Methanococcus maripaludis [TaxId: 39152]}
advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd
lg

Timeline for d3ewaa1:

• d3ewaa1 is new in SCOPe 2.03-stable
  
• d3ewaa1 appears in SCOPe 2.04
  
• d3ewaa1 appears in the current release, SCOPe 2.08