Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) contains one classic and one pseudo HhH motifs |
Family a.60.4.0: automated matches [227240] (1 protein) not a true family |
Protein automated matches [227003] (2 species) not a true protein |
Species Methanococcus maripaludis [TaxId:39152] [225662] (3 PDB entries) |
Domain d3ewaa1: 3ewa A:2-63 [209685] Other proteins in same PDB: d3ewaa2 automated match to d1pzna1 protein/DNA complex; complexed with anp, mg |
PDB Entry: 3ewa (more details), 2 Å
SCOPe Domain Sequences for d3ewaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ewaa1 a.60.4.0 (A:2-63) automated matches {Methanococcus maripaludis [TaxId: 39152]} advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd lg
Timeline for d3ewaa1: