SCOP 1.59: Domain d1fvec2: 1fve C:115-214

Lineage for d1fvec2 (1fve C:115-214)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
Species Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (2 PDB entries)
Domain d1fvec2: 1fve C:115-214 [20968]
Other proteins in same PDB: d1fvea1, d1fveb1, d1fvec1, d1fved1

Details for d1fvec2

PDB Entry: 1fve (more details), 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvec2 b.1.1.2 (C:115-214) Immunoglobulin (constant domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1fvec2:

Click to download the PDB-style file with coordinates for d1fvec2.
(The format of our PDB-style files is described here.)

Timeline for d1fvec2: