Lineage for d3etga2 (3etg A:209-501)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845468Protein automated matches [227005] (6 species)
    not a true protein
  7. 2845469Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries)
  8. 2845482Domain d3etga2: 3etg A:209-501 [209652]
    Other proteins in same PDB: d3etga1, d3etgb1, d3etgc1, d3etgd1, d3etge1, d3etgf1
    automated match to d1nr7a1
    complexed with glu, gtp, gwd, ndp

Details for d3etga2

PDB Entry: 3etg (more details), 2.5 Å

PDB Description: glutamate dehydrogenase complexed with gw5074
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etga2 c.2.1.7 (A:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d3etga2:

Click to download the PDB-style file with coordinates for d3etga2.
(The format of our PDB-style files is described here.)

Timeline for d3etga2: