SCOPe 2.05: Domain d3et9f1: 3et9 F:0-106

Lineage for d3et9f1 (3et9 F:0-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3et9f1: 3et9 F:0-106 [209637]
   automated match to d1h8na1

Details for d3et9f1

PDB Entry: 3et9, 2.8 Å

PDB Description: crystal structure of the engineered neutralizing antibody 1h

PDB Compounds: (F:) Antibody 1H light chain and antibody 1H heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3et9f1:

Sequence; same for both SEQRES and ATOM records:

>d3et9f1 b.1.1.0 (F:0-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdivliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrllpgvp
srfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtklei

Timeline for d3et9f1:

• d3et9f1 first appeared in SCOPe 2.03
  
• d3et9f1 appears in SCOPe 2.04
  
• d3et9f1 appears in SCOPe 2.06
  
• d3et9f1 appears in the current release, SCOPe 2.08