SCOPe 2.06: Domain d3essa1: 3ess A:427-633

Lineage for d3essa1 (3ess A:427-633)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d3essa1: 3ess A:427-633 [209628]
   Other proteins in same PDB: d3essa2
   automated match to d3ki0a_
   complexed with 18n

Details for d3essa1

PDB Entry: 3ess, 1.19 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with the 1,8-naphthalimide inhibitor

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d3essa1:

Sequence, based on SEQRES records:

>d3essa1 d.166.1.0 (A:427-633) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnntene
ekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtnt
plenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayee
laideeavakeqsistkppykerkdel

Sequence, based on observed residues (ATOM records):

>d3essa1 d.166.1.0 (A:427-633) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvekwgglyva
thaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntplenaeehi
tqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeelaideeava
keqsistkppykerkdel

Timeline for d3essa1:

• d3essa1 first appeared in SCOPe 2.03, called d3essa_
  
• d3essa1 was called d3essa_ in SCOPe 2.05
  
• d3essa1 appears in SCOPe 2.07
  
• d3essa1 appears in the current release, SCOPe 2.08