Lineage for d1fvda2 (1fvd A:109-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159614Species Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (2 PDB entries)
  8. 159615Domain d1fvda2: 1fvd A:109-214 [20962]
    Other proteins in same PDB: d1fvda1, d1fvdb1, d1fvdc1, d1fvdd1

Details for d1fvda2

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvda2 b.1.1.2 (A:109-214) Immunoglobulin (constant domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1fvda2:

Click to download the PDB-style file with coordinates for d1fvda2.
(The format of our PDB-style files is described here.)

Timeline for d1fvda2: