Lineage for d2mcph2 (2mcp H:122-222)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515147Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species)
  7. 1515148Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries)
  8. 1515151Domain d2mcph2: 2mcp H:122-222 [20961]
    Other proteins in same PDB: d2mcph1, d2mcpl1, d2mcpl2
    part of Fab MCPC603
    complexed with pc

Details for d2mcph2

PDB Entry: 2mcp (more details), 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
PDB Compounds: (H:) iga-kappa mcpc603 fab (heavy chain)

SCOPe Domain Sequences for d2mcph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcph2 b.1.1.2 (H:122-222) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]}
sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas
ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc

SCOPe Domain Coordinates for d2mcph2:

Click to download the PDB-style file with coordinates for d2mcph2.
(The format of our PDB-style files is described here.)

Timeline for d2mcph2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcph1