![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries) |
![]() | Domain d2mcph2: 2mcp H:122-222 [20961] Other proteins in same PDB: d2mcph1, d2mcpl1, d2mcpl2 part of Fab MCPC603 complexed with pc |
PDB Entry: 2mcp (more details), 3.1 Å
SCOPe Domain Sequences for d2mcph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcph2 b.1.1.2 (H:122-222) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
Timeline for d2mcph2: