![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
![]() | Domain d2mcpl2: 2mcp L:115-220 [20960] Other proteins in same PDB: d2mcph1, d2mcph2, d2mcpl1 part of Fab MCPC603 complexed with pc |
PDB Entry: 2mcp (more details), 3.1 Å
SCOP Domain Sequences for d2mcpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcpl2 b.1.1.2 (L:115-220) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2mcpl2: