Lineage for d2mcpl2 (2mcp L:115-220)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53877Species Fab MCPC603 (human), kappa L chain [48991] (2 PDB entries)
  8. 53881Domain d2mcpl2: 2mcp L:115-220 [20960]
    Other proteins in same PDB: d2mcph1, d2mcpl1

Details for d2mcpl2

PDB Entry: 2mcp (more details), 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcpl2 b.1.1.2 (L:115-220) Immunoglobulin (constant domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2mcpl2:

Click to download the PDB-style file with coordinates for d2mcpl2.
(The format of our PDB-style files is described here.)

Timeline for d2mcpl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcpl1