SCOP 1.57: Domain d1mcph2: 1mcp H:122-222

Lineage for d1mcph2 (1mcp H:122-222)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab MCPC603 (human), kappa L chain [48991] (2 PDB entries)

8. Domain d1mcph2: 1mcp H:122-222 [20959]
   Other proteins in same PDB: d1mcph1, d1mcpl1

Details for d1mcph2

PDB Entry: 1mcp, 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms

SCOP Domain Sequences for d1mcph2:

Sequence; same for both SEQRES and ATOM records:

>d1mcph2 b.1.1.2 (H:122-222) Immunoglobulin (constant domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas
ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc

Timeline for d1mcph2:

• d1mcph2 first appeared (with stable ids) in SCOP 1.55
  
• d1mcph2 appears in SCOP 1.59
  
• d1mcph2 appears in the current release, SCOPe 2.08