Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab MCPC603 (human), kappa L chain [48991] (2 PDB entries) |
Domain d1mcph2: 1mcp H:122-222 [20959] Other proteins in same PDB: d1mcph1, d1mcpl1 |
PDB Entry: 1mcp (more details), 2.7 Å
SCOP Domain Sequences for d1mcph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcph2 b.1.1.2 (H:122-222) Immunoglobulin (constant domains of L and H chains) {Fab MCPC603 (human), kappa L chain} sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
Timeline for d1mcph2: