Lineage for d3eond2 (3eon D:243-395)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732106Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)
  8. 1732130Domain d3eond2: 3eon D:243-395 [209587]
    Other proteins in same PDB: d3eona1, d3eonb1, d3eonc1, d3eond1
    automated match to d1siqa1
    complexed with 341

Details for d3eond2

PDB Entry: 3eon (more details), 2.55 Å

PDB Description: 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3eond2:

Sequence, based on SEQRES records: (download)

>d3eond2 a.29.3.0 (D:243-395) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqaff

Sequence, based on observed residues (ATOM records): (download)

>d3eond2 a.29.3.0 (D:243-395) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngsdefgvarh
lvnlevvntyedihalilgraqtgiqaff

SCOPe Domain Coordinates for d3eond2:

Click to download the PDB-style file with coordinates for d3eond2.
(The format of our PDB-style files is described here.)

Timeline for d3eond2: