Lineage for d3eomd1 (3eom D:3-242)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570604Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 2570624Domain d3eomd1: 3eom D:3-242 [209578]
    Other proteins in same PDB: d3eoma2, d3eomb2, d3eomc2, d3eomd2
    automated match to d1siqa2

Details for d3eomd1

PDB Entry: 3eom (more details), 2.4 Å

PDB Description: 2.4 a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3eomd1:

Sequence, based on SEQRES records: (download)

>d3eomd1 e.6.1.0 (D:3-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
ylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvw
akldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3eomd1 e.6.1.0 (D:3-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
ylpklatgewigcfgltepsmvtrarkvpggyslsgskmwitnspiadvfvvwaklddgr
deirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3eomd1:

Click to download the PDB-style file with coordinates for d3eomd1.
(The format of our PDB-style files is described here.)

Timeline for d3eomd1: