Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries) |
Domain d3eo0a1: 3eo0 A:1-108 [209565] Other proteins in same PDB: d3eo0a2, d3eo0c2 automated match to d1rhha1 complexed with gol |
PDB Entry: 3eo0 (more details), 1.75 Å
SCOPe Domain Sequences for d3eo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo0a1 b.1.1.1 (A:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]} etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleik
Timeline for d3eo0a1: