SCOP 1.69: Domain d2fgwl2: 2fgw L:109-214

Lineage for d2fgwl2 (2fgw L:109-214)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2fgwl2: 2fgw L:109-214 [20956]
   Other proteins in same PDB: d2fgwh1, d2fgwh2, d2fgwl1
   part of humanized Fab H52

Details for d2fgwl2

PDB Entry: 2fgw, 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwl2:

Sequence; same for both SEQRES and ATOM records:

>d2fgwl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d2fgwl2:

• d2fgwl2 first appeared (with stable ids) in SCOP 1.55
  
• d2fgwl2 appears in SCOP 1.67
  
• d2fgwl2 appears in SCOP 1.71
  
• d2fgwl2 appears in the current release, SCOPe 2.08