Lineage for d2fgwl2 (2fgw L:109-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53792Species Fab H52 (synthetic, humanised version), kappa L chain [48990] (1 PDB entry)
  8. 53794Domain d2fgwl2: 2fgw L:109-214 [20956]
    Other proteins in same PDB: d2fgwh1, d2fgwl1

Details for d2fgwl2

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgwl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d2fgwl2:

Click to download the PDB-style file with coordinates for d2fgwl2.
(The format of our PDB-style files is described here.)

Timeline for d2fgwl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwl1