Lineage for d3en6a_ (3en6 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1433768Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1433769Species Chicken (Gallus gallus) [TaxId:9031] [56157] (37 PDB entries)
  8. 1433789Domain d3en6a_: 3en6 A: [209557]
    automated match to d2gqgb_
    complexed with ks5

Details for d3en6a_

PDB Entry: 3en6 (more details), 2.39 Å

PDB Description: targeted polypharmacology: crystal structure of the c-src kinase domain in complex with pp102, a multitargeted kinase inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3en6a_:

Sequence, based on SEQRES records: (download)

>d3en6a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
weipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrh
eklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayver
mnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrf
tiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcw
rkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d3en6a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
weipreslrlevklgqgevwmgtwngttrvaiktlqvmkklrheklvqlyavvseepiyi
vteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraanilvge
nlvckvapikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqver
gyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d3en6a_:

Click to download the PDB-style file with coordinates for d3en6a_.
(The format of our PDB-style files is described here.)

Timeline for d3en6a_: