Lineage for d2fbjh2 (2fbj H:119-220)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221563Species Fab J539 (mouse), kappa L chain [48989] (1 PDB entry)
  8. 221564Domain d2fbjh2: 2fbj H:119-220 [20955]
    Other proteins in same PDB: d2fbjh1, d2fbjl1
    complexed with fuc, nag, zn

Details for d2fbjh2

PDB Entry: 2fbj (more details), 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin (constant domains of L and H chains) {Fab J539 (mouse), kappa L chain}
esarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasg
grytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg

SCOP Domain Coordinates for d2fbjh2:

Click to download the PDB-style file with coordinates for d2fbjh2.
(The format of our PDB-style files is described here.)

Timeline for d2fbjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fbjh1