Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (49 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [225532] (1 PDB entry) |
Domain d3ek1a1: 3ek1 A:1-483 [209535] Other proteins in same PDB: d3ek1a2 automated match to d1o9ja_ complexed with mes, so4 |
PDB Entry: 3ek1 (more details), 2.1 Å
SCOPe Domain Sequences for d3ek1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ek1a1 c.82.1.0 (A:1-483) automated matches {Brucella melitensis [TaxId: 359391]} mlalkdpsllksqclvngrwidaadgttikvtnpadgsvigtvpslsvatikeaidasak alsgwaaktakeragilrkwfdliianaddialimtseqgkplaeargevlyaasfiewf aeeakrvygdtipapqngqrltvirqpvgvtaaitpwnfpaamitrkaapalaagctmiv rpadltpltalalgvlaekagipagvlqivtgkareigaeltsndtvrklsftgstevgr llmaqcaptikrislelggnapfivfddadldaavdgamvskyrnagqtcvcanriyvqr gvydkfaeklaakvkelkvgngtepgvvigpmieekaitkvkahiedavskgaklitggk elgglffepgiltgvtsdmlvakeetfgplaplfafdteeeviaqandtifglaayfyte nfsrairvsealeygmvghntglisnevapfggvkqsglgregskygieeyletkyicsa ykr
Timeline for d3ek1a1: