Lineage for d2ig2h2 (2ig2 H:120-231)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785078Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
    SQ NA # humanized antibody
    Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 785306Domain d2ig2h2: 2ig2 H:120-231 [20953]
    Other proteins in same PDB: d2ig2h1, d2ig2l1, d2ig2l2
    part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2h2

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)
PDB Compounds: (H:) igg1-lambda kol fab (heavy chain)

SCOP Domain Sequences for d2ig2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2h2 b.1.1.2 (H:120-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp

SCOP Domain Coordinates for d2ig2h2:

Click to download the PDB-style file with coordinates for d2ig2h2.
(The format of our PDB-style files is described here.)

Timeline for d2ig2h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2h1