Lineage for d2fb4l2 (2fb4 L:110-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53851Species Fab KOL (human), lambda L chain [48988] (2 PDB entries)
  8. 53853Domain d2fb4l2: 2fb4 L:110-214 [20950]
    Other proteins in same PDB: d2fb4h1, d2fb4l1

Details for d2fb4l2

PDB Entry: 2fb4 (more details), 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2fb4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb4l2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {Fab KOL (human), lambda L chain}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d2fb4l2:

Click to download the PDB-style file with coordinates for d2fb4l2.
(The format of our PDB-style files is described here.)

Timeline for d2fb4l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fb4l1