Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1faih2: 1fai H:124-221 [20949] Other proteins in same PDB: d1faih1, d1fail1, d1fail2 part of Fab R19.9 |
PDB Entry: 1fai (more details), 2.7 Å
SCOP Domain Sequences for d1faih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1faih2 b.1.1.2 (H:124-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} sakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs alytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
Timeline for d1faih2: