Lineage for d1faih2 (1fai H:124-221)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104359Species Fab R19.9 (mouse), kappa L chain [48987] (2 PDB entries)
  8. 104360Domain d1faih2: 1fai H:124-221 [20949]
    Other proteins in same PDB: d1faih1, d1fail1

Details for d1faih2

PDB Entry: 1fai (more details), 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d1faih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faih2 b.1.1.2 (H:124-221) Immunoglobulin (constant domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
sakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
alytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

SCOP Domain Coordinates for d1faih2:

Click to download the PDB-style file with coordinates for d1faih2.
(The format of our PDB-style files is described here.)

Timeline for d1faih2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1faih1