SCOP 1.55: Domain d1faih2: 1fai H:124-221

Lineage for d1faih2 (1fai H:124-221)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab R19.9 (mouse), kappa L chain [48987] (2 PDB entries)

8. Domain d1faih2: 1fai H:124-221 [20949]
   Other proteins in same PDB: d1faih1, d1fail1

Details for d1faih2

PDB Entry: 1fai, 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d1faih2:

Sequence; same for both SEQRES and ATOM records:

>d1faih2 b.1.1.2 (H:124-221) Immunoglobulin (constant domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
sakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
alytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

Timeline for d1faih2:

• d1faih2 appears in SCOP 1.57
  
• d1faih2 appears in the current release, SCOPe 2.07