Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (17 species) not a true protein |
Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries) |
Domain d3ef5a_: 3ef5 A: [209482] automated match to d3gwyb_ protein/RNA complex; complexed with dgt |
PDB Entry: 3ef5 (more details), 2.6 Å
SCOPe Domain Sequences for d3ef5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ef5a_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]} hwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgiea evgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrki lhkiykalglew
Timeline for d3ef5a_: